PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00018.1.g00360.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 451aa    MW: 49004.9 Da    PI: 7.4565
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00018.1.g00360.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.9e-192986457
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                                      ++t+eq+e+Le+++ ++++ps  +r+++ +++    +++ +q+kvWFqNrR +ek+
  Zpz_sc00018.1.g00360.1.sm.mkhc 29 YVRYTPEQVEALERVYSECPKPSSLRRQQIIRECpilsNIEPKQIKVWFQNRRCREKQ 86
                                    6789****************************************************97 PP

2START56.31e-181772812106
                                     HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEE CS
                           START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakae 80 
                                     +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++  v+e+l+d++ W ++++ ++
  Zpz_sc00018.1.g00360.1.sm.mkhc 177 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIIAVSHNCSGVAARACGLVSLEPT-KVAEILKDRPSWYRDCRCVD 254
                                     6899******************************************************.8888888888********** PP

                                     EEEEECTT..EEEEEEEEXXTTXX-SSX CS
                           START  81 tlevissg..galqlmvaelqalsplvp 106
                                     +l vi +g  g+++l+++++   +p  p
  Zpz_sc00018.1.g00360.1.sm.mkhc 255 VLHVIPTGngGTIELIYMQSTG-GPSGP 281
                                     ****************999987.66655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-181483IPR009057Homeodomain-like
PROSITE profilePS5007115.2562387IPR001356Homeobox domain
SMARTSM003893.8E-152591IPR001356Homeobox domain
SuperFamilySSF466895.56E-172790IPR009057Homeodomain-like
CDDcd000861.29E-162888No hitNo description
PfamPF000462.3E-162986IPR001356Homeobox domain
CDDcd146861.38E-680119No hitNo description
Gene3DG3DSA:1.20.5.1706.6E-484132No hitNo description
Gene3DG3DSA:3.30.530.208.2E-5175284IPR023393START-like domain
SuperFamilySSF559611.51E-12177320No hitNo description
PfamPF018527.9E-16177281IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MAAMVAAGGG KDRSSPGGGG APQVDTGKYV RYTPEQVEAL ERVYSECPKP SSLRRQQIIR  60
ECPILSNIEP KQIKVWFQNR RCREKQRKEA SRLQTVNRKL TAMNKLLMEE NDRLQKQVSR  120
LVYENGYMKQ QLHNPSVATT DTSCESVVTS GQHHQQQNSA APRPPRDANN PAGLLAIAEE  180
TLAEFLSKAT GTAVDWVQMV GMKPGPDSIG IIAVSHNCSG VAARACGLVS LEPTKVAEIL  240
KDRPSWYRDC RCVDVLHVIP TGNGGTIELI YMQSTGGPSG PNTPNFVRAE AWSVPEVLRP  300
LYESPKILAQ KTTIAALRHI RQIAHESSGE MPYNVPPALL VRFLREHRSE WADPGVDAYS  360
AAALRASPYA VPGLQASGFM GSQVILPLAH TLEHEQLCSG VDENAAGACA QLVFAPIDES  420
FADDAPLLPS GFCVIPLDAK TLSDISLVAR I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1032840.0AK103284.1 Oryza sativa Japonica Group cDNA clone:J033124M18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982339.10.0PREDICTED: homeobox-leucine zipper protein HOX32
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
SwissprotA2XK300.0HOX32_ORYSI; Homeobox-leucine zipper protein HOX32
TrEMBLK4A5S40.0K4A5S4_SETIT; Uncharacterized protein
STRINGSi034228m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1849158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.11e-165HD-ZIP family protein